PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 268aa    MW: 30474.8 Da    PI: 5.9862
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627209.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-151460147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+WTteEd++l++ +   G  +W++ ++  g++R++k+c++rw +y
   XP_013627209.1 14 KGPWTTEEDKKLINFILNNGHCCWRALPKLAGLRRCGKSCRLRWTNY 60
                     79********************************************9 PP

2Myb_DNA-binding50.54.8e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + eE++l +d+++  G++ W++Ia++++ gRt++++k++w+++
   XP_013627209.1  71 SHEEEQLVIDLHAHIGNK-WSKIASRLP-GRTDNEIKNHWNTH 111
                      89****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-20562IPR009057Homeodomain-like
PROSITE profilePS5129412.955961IPR017930Myb domain
SuperFamilySSF466894.49E-2611108IPR009057Homeodomain-like
SMARTSM007171.7E-101363IPR001005SANT/Myb domain
PfamPF002491.7E-131460IPR001005SANT/Myb domain
CDDcd001677.24E-81661No hitNo description
PROSITE profilePS5129426.84862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2463117IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PfamPF002492.0E-1470111IPR001005SANT/Myb domain
CDDcd001671.03E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTTE EDKKLINFIL NNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
IRPDLRRGLL SHEEEQLVID LHAHIGNKWS KIASRLPGRT DNEIKNHWNT HIKKKLVKMG  120
IDPVTHQPLN QDPNSTDNPK NSCSVSDDIS MVTKSSSTKN IETNGTTTED ESISTITDQN  180
SSMDNDNHQL SNIYNDEEFF SYLWSDESTK AETPWSDSNY DVGGTLYHDN NVSCAGADFP  240
ICSPERINGV DWTFQDYCQD FGVHDFGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627209.10.0PREDICTED: protein ODORANT1-like isoform X1
RefseqXP_013701026.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX65e-87ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D3BL080.0A0A0D3BL08_BRAOL; Uncharacterized protein
STRINGBra020837.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-147myb domain protein 85